PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G016964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family BBR-BPC
Protein Properties Length: 338aa    MW: 37860.9 Da    PI: 9.8821
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G016964.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind392.75.2e-12013371301
             GAGA_bind   1 mdddgsre..rnkg.yyepa..aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkll 82 
                           mdd g+re  r+kg +++p+  + + +++   +q+m++++erda+i+ernlalsekkaa+aerdmaflqrd+a+aern+a++erdn+++
  HL.SW.v1.0.G016964.1   1 MDDAGHREngRHKGdQFKPTqgQWMMQHQptMKQIMAIMTERDAAIQERNLALSEKKAALAERDMAFLQRDAAIAERNNAMLERDNAIA 89 
                           9*****999*********776655555542257******************************************************** PP

             GAGA_bind  83 alllvensla....salpvgvqvlsgtksidslqqlse..pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak 165
                           +l+++ens++    s++p+g+q+++g+k++++ qq+ +  +++++ ++ +re++++++lp++  +++a ++++ k      + ke+k  
  HL.SW.v1.0.G016964.1  90 TLQYRENSMSngnmSSCPPGCQISRGVKHMHHPQQHVHqlQHINEASYSTREMNTSDSLPMSADTSDAVKSRRGK------RIKEPKPI 172
                           ********9999999********************6665889999***************988777766665555......44444444 PP

             GAGA_bind 166 kkkkksekskkkvkkesader.............................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkW 225
                           +++k+ +k+ +k kkes++ +                             sk+++k +dl+ln+v +Dest+P+PvCsCtG+lrqCYkW
  HL.SW.v1.0.G016964.1 173 SPNKRAPKPPRKIKKESEELNkmtfvksqewkggqsmvgegdednkqlvvSKSDWKGQDLGLNQVVYDESTMPAPVCSCTGVLRQCYKW 261
                           444444444444444444422345555567999******************************************************** PP

             GAGA_bind 226 GnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                           GnGGWqS+CCttt+S+yPLP ++++r+aR++grKmS++af+klL++LaaeG+dlsnpvDLkd WAkHGtn+++ti+
  HL.SW.v1.0.G016964.1 262 GNGGWQSSCCTTTMSMYPLPSVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVDLKDNWAKHGTNRYITIK 337
                           ***************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-1671337IPR010409GAGA-binding transcriptional activator
PfamPF062171.7E-1031337IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDDAGHRENG RHKGDQFKPT QGQWMMQHQP TMKQIMAIMT ERDAAIQERN LALSEKKAAL  60
AERDMAFLQR DAAIAERNNA MLERDNAIAT LQYRENSMSN GNMSSCPPGC QISRGVKHMH  120
HPQQHVHQLQ HINEASYSTR EMNTSDSLPM SADTSDAVKS RRGKRIKEPK PISPNKRAPK  180
PPRKIKKESE ELNKMTFVKS QEWKGGQSMV GEGDEDNKQL VVSKSDWKGQ DLGLNQVVYD  240
ESTMPAPVCS CTGVLRQCYK WGNGGWQSSC CTTTMSMYPL PSVPNKRHAR VGGRKMSGSA  300
FNKLLSRLAA EGHDLSNPVD LKDNWAKHGT NRYITIK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884826.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884825.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884824.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884823.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884822.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-161BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLW9RR460.0W9RR46_9R
STRINGGLYMA04G02860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69053449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-145basic pentacysteine 6